Skip to main content
  • Home
  • Development
  • Documentation
  • Donate
  • Operational login
  • Browse the archive

swh logo
SoftwareHeritage
Software
Heritage
Archive
Features
  • Search

  • Downloads

  • Save code now

  • Add forge now

  • Help

https://github.com/nbraffman/CylK-homologs
10 September 2025, 15:48:34 UTC
  • Code
  • Branches (1)
  • Releases (0)
  • Visits
    • Branches
    • Releases
    • HEAD
    • refs/heads/main
    • 732a38ef8ab73988203ea1933158238ea90361b0
    No releases to show
  • 03ea778
  • /
  • licheniforme.fasta
Raw File Download
Take a new snapshot of a software origin

If the archived software origin currently browsed is not synchronized with its upstream version (for instance when new commits have been issued), you can explicitly request Software Heritage to take a new snapshot of it.

Use the form below to proceed. Once a request has been submitted and accepted, it will be processed as soon as possible. You can then check its processing state by visiting this dedicated page.
swh spinner

Processing "take a new snapshot" request ...

To reference or cite the objects present in the Software Heritage archive, permalinks based on SoftWare Hash IDentifiers (SWHIDs) must be used.
Select below a type of object currently browsed in order to display its associated SWHID and permalink.

  • content
  • directory
  • revision
  • snapshot
origin badgecontent badge Iframe embedding
swh:1:cnt:e467ea8048c46302c4f8968cd91379d32b2d84dc
origin badgedirectory badge Iframe embedding
swh:1:dir:03ea778787084907598b932648568a69c4d99c91
origin badgerevision badge
swh:1:rev:732a38ef8ab73988203ea1933158238ea90361b0
origin badgesnapshot badge
swh:1:snp:c8e163a9a31072f05ae0e334e64580bd4c6b0c6d

This interface enables to generate software citations, provided that the root directory of browsed objects contains a citation.cff or codemeta.json file.
Select below a type of object currently browsed in order to generate citations for them.

  • content
  • directory
  • revision
  • snapshot
Generate software citation in BibTex format (requires biblatex-software package)
Generating citation ...
Generate software citation in BibTex format (requires biblatex-software package)
Generating citation ...
Generate software citation in BibTex format (requires biblatex-software package)
Generating citation ...
Generate software citation in BibTex format (requires biblatex-software package)
Generating citation ...
Tip revision: 732a38ef8ab73988203ea1933158238ea90361b0 authored by nbraffman on 29 November 2021, 18:59:23 UTC
Update README.md
Tip revision: 732a38e
licheniforme.fasta
>CylK_licheniforme
MKKNKKTTKSLLSADEKITESLRSTLSDVLPDQLQTYIRTVLQFSGRPEGANLLTGPNTEIEFFSQDPNKNFPNIFAKYSNVLTVSSDPNFITSEDEEVKIIWGRHGSDSLIGFDPGADLVGKRRIDIFLGDFIDEQFNPIPGALNAGKSWSDRFILGDWQKPYYFEDDETLGLNQSAMILDFNPNEDVIQLHGDRQDYELVNISLGTAIFWREKKGYDLIGVLGGVSDLSLKGDYFEFKGNTAPKTVLKTAEHIGTAANDYIFSSTVDAKGNFYVGGGTGGSLGGRNIGARDAWLAKYDSNGNQRWSRQFGSTGTESLWGMASDGSNIYVAGNTTGQLENNTVKGGNDAYLAKYDSDGNQVWIKQNGTYTLEESYKITVDSSGNIYTAGHTFGSLGGPNQNLEQGEVFELPSTDGYVAKFDSNGNQLWVAQFGTITLDDNWGVAADNNGNVFAGGNTKGSFGAKNTGTAGEYDAWLVKLNKDGQTDWVRQFGTPNYDFMWDIETDSLGDIYATGWTLGDLGGKNAGSYDVWLAKYNTNGNQLWIKQFGTSEDDAPFLDGIDIDANDNIFLTGNTNGNLGGANAGSYDAWAAKFDKDGNQLWLKQFGTPDYDTATTVTAVNFGKLYVSGITEGSLGTTNAGSYDSWALKLDADNGEIQDFNSSTNTFGQTGFLNLG

back to top

Software Heritage — Copyright (C) 2015–2025, The Software Heritage developers. License: GNU AGPLv3+.
The source code of Software Heritage itself is available on our development forge.
The source code files archived by Software Heritage are available under their own copyright and licenses.
Terms of use: Archive access, API— Content policy— Contact— JavaScript license information— Web API